PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_33964g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 361aa    MW: 40257.1 Da    PI: 4.7636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_33964g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  +   G  +W+++++  g+ R++k+c++rw +yl
    MA_33964g0010 14 KGPWTAEEDQKLISFILHNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.17.6e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l++d++ qlG++ W++Ia +++ gRt++++k++w+++
    MA_33964g0010  70 LSESEEQLIIDLHSQLGNR-WSKIAGHLP-GRTDNEIKNYWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.905961IPR017930Myb domain
SuperFamilySSF466891.95E-2711108IPR009057Homeodomain-like
SMARTSM007174.9E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-141461IPR001005SANT/Myb domain
CDDcd001673.26E-91661No hitNo description
PROSITE profilePS5129426.56762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2564117IPR009057Homeodomain-like
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1470111IPR001005SANT/Myb domain
CDDcd001673.71E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLISFIL HNGHCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SESEEQLIID LHSQLGNRWS KIAGHLPGRT DNEIKNYWNT HIKKKLKRMG  120
IDPVTHRPIT DQTESKPSKP AFDEATEESD SNPTKKEILQ AVTEVSCRSN DSEITEEAEK  180
SIDSVKAVKL EAAQLATGYG FDPMLFDERS STVYLCDLPV TENQNMENSS LDFVGNALFR  240
SASDDQSLLE FAEVPPPGII SGPLKSQEGL NDELALINPC SSFNVPLETS TSNSADQELQ  300
WTNEVSNAAT ANYDILLGGA ESIPETDMQL WHIEHLQSAF DAGWDIHHGV NNTIFSNPLF  360
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1067110.0BT106711.1 Picea glauca clone GQ03008_L22 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838010.17e-87PREDICTED: protein ODORANT1
TrEMBLW1NYY37e-87W1NYY3_AMBTC; Uncharacterized protein
STRINGGLYMA11G33620.12e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-86myb domain protein 43